Skip to main navigation Skip to search Skip to main content

Neurobiochemical, Peptidomic, and Bioinformatic Approaches to Characterize Tauopathy Peptidome Biomarker Candidates in Experimental Mouse Model of Traumatic Brain Injury

  • Hamad Yadikar
  • , Connor Johnson
  • , Niko Pafundi
  • , Lynn Nguyen
  • , Milin Kurup
  • , Isabel Torres
  • , Albandery Al-Enezy
  • , Zhihui Yang
  • , Richard Yost
  • , Firas H. Kobeissy
  • , Kevin K.W. Wang

Research output: Contribution to journalArticlepeer-review

3 Scopus citations

Abstract

Traumatic brain injury (TBI) is a multidimensional damage, and currently, no FDA-approved medicine is available. Multiple pathways in the cell are triggered through a head injury (e.g., calpain and caspase activation), which truncate tau and generate variable fragment sizes (MW 400–45,000 K). In this study, we used an open-head TBI mouse model generated by controlled cortical impact (CCI) and collected ipsilateral (IC) and contralateral (CC) mice htau brain cortices at one (D1) three (D3), and seven (D7) days post-injury. We implemented immunological (antibody-based detection) and peptidomic approaches (nano-reversed-phase liquid chromatography/tandem mass spectrometry) to investigate proteolytic tau peptidome (low molecular weight (LMW) < 10 K)) and pathological phosphorylation sites (high-molecular-weight (HMW); > 10 K) derived from CCI-TBI animal models. Our immunoblotting analysis verified tau hyperphosphorylation, HMW, and HMW breakdown products (HMW-BDP) formation of tau (e.g., pSer202, pThr181, pThr231, pSer396, and pSer404), following CCI-TBI. Peptidomic data revealed unique sequences of injury-dependent proteolytic peptides generated from human tau protein. Among the N-terminal tau peptides, EIPEGTTAEEAGIGDTPSLEDEAAGHVTQA (a.a. 96–125) and AQPHTEIPEGTTAEEAGIGDTPSLEDEAAGHVTQARM (a.a. 91–127). Examples of tau C-terminal peptides identified include NVSSTGSIDMVDSPQLATLADEVSASLAKQGL (a.a. 410–441) and QLATLADEVSASLAKQGL (a.a. 424–441). Our peptidomic bioinformatic tools showed the association of proteases, such as CAPN1, CAPN2, and CTSL; CASP1, MMP7, and MMP9; and ELANE, GZMA, and MEP1A, in CCI-TBI tau peptidome. In clinical trials for novel TBI treatments, it might be useful to monitor a subset of tau peptidome as targets for biomarker utility and use them for a “theranostic” approach.

Original languageEnglish
Pages (from-to)2295-2319
Number of pages25
JournalMolecular Neurobiology
Volume60
Issue number4
DOIs
StatePublished - Apr 2023

Keywords

  • CCI
  • Peptidome Biomarkers
  • Peptidomics
  • Tau phosphorylation
  • Tauopathy
  • TBI

Funding Agency

  • Kuwait Foundation for the Advancement of Sciences

Fingerprint

Dive into the research topics of 'Neurobiochemical, Peptidomic, and Bioinformatic Approaches to Characterize Tauopathy Peptidome Biomarker Candidates in Experimental Mouse Model of Traumatic Brain Injury'. Together they form a unique fingerprint.

Cite this